|
corticotropin-releasing hormone (ovine) |
|
CHEBI:65307 |
|
A corticotropin-releasing hormone from sheep composed of Ser, Gln, Glu, Pro, Pro, Ile, Ser, Leu, Asp, Leu, Val, Phe, His, Leu, Leu, Arg, Glu, Val, Leu, Glu, Met, Thr, Lys, Ala, Asp, Gln, Leu, Ala, Gln, Gln, Ala, His, Ser, Asn, Arg, Lys, Leu, Leu, Asp, Ile and Ala-NH2 residues joined in sequence. |
|
 
This entity has been manually annotated by the ChEBI Team.
|
|
No supplier information found for this compound. |
|
Molfile
XML
SDF
|
|
|
|
Corticotropin-releasing hormone (CRH) (also known as corticotropin-releasing factor (CRF) or corticoliberin; corticotropin may also be spelled corticotrophin) is a peptide hormone involved in stress responses. It is a releasing hormone that belongs to corticotropin-releasing factor family. In humans, it is encoded by the CRH gene. Its main function is the stimulation of the pituitary synthesis of adrenocorticotropic hormone (ACTH), as part of the hypothalamic–pituitary–adrenal axis (HPA axis).
Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 196-amino acid preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Increased CRH production has been observed to be associated with Alzheimer's disease and major depression, and autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially fatal metabolic consequences including hypoglycemia.
In addition to being produced in the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes, and is highly expressed in the placenta. In the placenta, CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition.
A recombinant version for diagnostics is called corticorelin (INN).
|
Read full article at Wikipedia
|
InChI=1S/C206H341N59O62S/c1- 31- 106(23) 161(200(323) 226- 108(25) 164(215) 287) 261- 194(317) 143(88- 158(285) 286) 254- 185(308) 133(78- 100(11) 12) 247- 183(306) 131(76- 98(7) 8) 245- 173(296) 118(47- 37- 39- 68- 208) 232- 171(294) 119(48- 40- 69- 222- 205(216) 217) 234- 190(313) 140(85- 152(214) 274) 252- 195(318) 144(92- 267) 257- 189(312) 138(83- 114- 89- 220- 94- 224- 114) 242- 166(289) 110(27) 228- 170(293) 121(52- 59- 148(210) 270) 235- 174(297) 122(53- 60- 149(211) 271) 230- 165(288) 109(26) 229- 180(303) 129(74- 96(3) 4) 244- 177(300) 124(55- 62- 151(213) 273) 237- 191(314) 141(86- 156(281) 282) 243- 167(290) 111(28) 227- 169(292) 117(46- 36- 38- 67- 207) 240- 202(325) 163(112(29) 269) 263- 179(302) 127(66- 73- 328- 30) 239- 175(298) 125(56- 63- 153(275) 276) 238- 182(305) 135(80- 102(15) 16) 255- 198(321) 159(104(19) 20) 259- 178(301) 126(57- 64- 154(277) 278) 236- 172(295) 120(49- 41- 70- 223- 206(218) 219) 233- 181(304) 130(75- 97(5) 6) 246- 184(307) 132(77- 99(9) 10) 248- 188(311) 139(84- 115- 90- 221- 95- 225- 115) 251- 187(310) 137(82- 113- 44- 34- 33- 35- 45- 113) 256- 199(322) 160(105(21) 22) 260- 193(316) 136(81- 103(17) 18) 249- 192(315) 142(87- 157(283) 284) 253- 186(309) 134(79- 101(13) 14) 250- 196(319) 145(93- 268) 258- 201(324) 162(107(24) 32- 2) 262- 197(320) 146- 50- 42- 71- 264(146) 204(327) 147- 51- 43- 72- 265(147) 203(326) 128(58- 65- 155(279) 280) 241- 176(299) 123(54- 61- 150(212) 272) 231- 168(291) 116(209) 91- 266/h33- 35,44- 45,89- 90,94- 112,116- 147,159- 163,266- 269H,31- 32,36- 43,46- 88,91- 93,207- 209H2,1- 30H3,(H2,210,270) (H2,211,271) (H2,212,272) (H2,213,273) (H2,214,274) (H2,215,287) (H,220,224) (H,221,225) (H,226,323) (H,227,292) (H,228,293) (H,229,303) (H,230,288) (H,231,291) (H,232,294) (H,233,304) (H,234,313) (H,235,297) (H,236,295) (H,237,314) (H,238,305) (H,239,298) (H,240,325) (H,241,299) (H,242,289) (H,243,290) (H,244,300) (H,245,296) (H,246,307) (H,247,306) (H,248,311) (H,249,315) (H,250,319) (H,251,310) (H,252,318) (H,253,309) (H,254,308) (H,255,321) (H,256,322) (H,257,312) (H,258,324) (H,259,301) (H,260,316) (H,261,317) (H,262,320) (H,263,302) (H,275,276) (H,277,278) (H,279,280) (H,281,282) (H,283,284) (H,285,286) (H4,216,217,222) (H4,218,219,223) /t106- ,107- ,108- ,109- ,110- ,111- ,112+,116- ,117- ,118- ,119- ,120- ,121- ,122- ,123- ,124- ,125- ,126- ,127- ,128- ,129- ,130- ,131- ,132- ,133- ,134- ,135- ,136- ,137- ,138- ,139- ,140- ,141- ,142- ,143- ,144- ,145- ,146- ,147- ,159- ,160- ,161- ,162- ,163- /m0/s1 |
QMZRMXQCHRPRQD-SAWSQHHPSA-N |
CC[C@H] (C) [C@H] (NC(=O) [C@H] (CC(O) =O) NC(=O) [C@H] (CC(C) C) NC(=O) [C@H] (CC(C) C) NC(=O) [C@H] (CCCCN) NC(=O) [C@H] (CCCNC(N) =N) NC(=O) [C@H] (CC(N) =O) NC(=O) [C@H] (CO) NC(=O) [C@H] (Cc1c[nH] cn1) NC(=O) [C@H] (C) NC(=O) [C@H] (CCC(N) =O) NC(=O) [C@H] (CCC(N) =O) NC(=O) [C@H] (C) NC(=O) [C@H] (CC(C) C) NC(=O) [C@H] (CCC(N) =O) NC(=O) [C@H] (CC(O) =O) NC(=O) [C@H] (C) NC(=O) [C@H] (CCCCN) NC(=O) [C@@H] (NC(=O) [C@H] (CCSC) NC(=O) [C@H] (CCC(O) =O) NC(=O) [C@H] (CC(C) C) NC(=O) [C@@H] (NC(=O) [C@H] (CCC(O) =O) NC(=O) [C@H] (CCCNC(N) =N) NC(=O) [C@H] (CC(C) C) NC(=O) [C@H] (CC(C) C) NC(=O) [C@H] (Cc1c[nH] cn1) NC(=O) [C@H] (Cc1ccccc1) NC(=O) [C@@H] (NC(=O) [C@H] (CC(C) C) NC(=O) [C@H] (CC(O) =O) NC(=O) [C@H] (CC(C) C) NC(=O) [C@H] (CO) NC(=O) [C@@H] (NC(=O) [C@@H] 1CCCN1C(=O) [C@@H] 1CCCN1C(=O) [C@H] (CCC(O) =O) NC(=O) [C@H] (CCC(N) =O) NC(=O) [C@@H] (N) CO) [C@@H] (C) CC) C(C) C) C(C) C) [C@@H] (C) O) C(=O) N[C@@H] (C) C(N) =O |
|
Bronsted base
A molecular entity capable of accepting a hydron from a donor (Bronsted acid).
(via organic amino compound )
|
|
neurotransmitter
An endogenous compound that is used to transmit information across the synapse between a neuron and another cell.
(via corticotropin-releasing hormone )
hormone
Originally referring to an endogenous compound that is formed in specialized organ or group of cells and carried to another organ or group of cells, in the same organism, upon which it has a specific regulatory function, the term is now commonly used to include non-endogenous, semi-synthetic and fully synthetic analogues of such compounds.
(via peptide hormone )
|
|
diagnostic agent
A substance administered to aid diagnosis of a disease.
|
|
View more via ChEBI Ontology
L- seryl- L- glutaminyl- L- α- glutamyl- L- prolyl- L- prolyl- L- isoleucyl- L- seryl- L- leucyl- L- α- aspartyl- L- leucyl- L- valyl- L- phenylalanyl- L- histidyl- L- leucyl- L- leucyl- L- arginyl- L- α- glutamyl- L- valyl- L- leucyl- L- α- glutamyl- L- methionyl- L- threonyl- L- lysyl- L- alanyl- L- α- aspartyl- L- glutaminyl- L- leucyl- L- alanyl- L- glutaminyl- L- glutaminyl- L- alanyl- L- histidyl- L- seryl- L- asparaginyl- L- arginyl- L- lysyl- L- leucyl- L- leucyl- L- α- aspartyl- L- isoleucyl- L- alaninamide
|
Corticotropin-releasing factor (sheep hypothalamus)
|
ChemIDplus
|
Corticotropin-releasing factor (sheep)
|
ChemIDplus
|
Ovine ACTH releasing factor
|
ChemIDplus
|
Ovine corticotropin-releasing factor
|
ChemIDplus
|
Ovine CRF 41
|
ChemIDplus
|
Ovine CRH
|
ChemIDplus
|
Ser- Gln- Glu- Pro- Pro- Ile- Ser- Leu- Asp- Leu- Val- Phe- His- Leu- Leu- Arg- Glu- Val- Leu- Glu- Met- Thr- Lys- Ala- Asp- Gln- Leu- Ala- Gln- Gln- Ala- His- Ser- Asn- Arg- Lys- Leu- Leu- Asp- Ile- Ala- NH2
|
ChEBI
|
Sheep corticotropin-releasing factor (1-41)
|
ChemIDplus
|
sheep corticotropin-releasing hormone
|
ChEBI
|
SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
|
ChEBI
|
79804-71-0
|
CAS Registry Number
|
ChemIDplus
|
|